PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM10G18660.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 310aa    MW: 33042.1 Da    PI: 8.9755
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM10G18660.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.94e-19155209256
                      T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      rk+ +++k+q  +Le+ F+++++++ ++++ LA++l+L+ rqV vWFqNrRa+ k
  OGLUM10G18660.1 155 RKKLRLSKDQAAVLEDTFKEHNTLNPKQKAALARQLNLKPRQVEVWFQNRRARTK 209
                      788899***********************************************98 PP

2HD-ZIP_I/II126.11.5e-40155244191
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                      +kk+rlsk+q+++LE++F+e+++L+p++K++lar+L+l+prqv+vWFqnrRARtk+kq+E+d+e Lkr++++l++en+rL++e +eLr +l
  OGLUM10G18660.1 155 RKKLRLSKDQAAVLEDTFKEHNTLNPKQKAALARQLNLKPRQVEVWFQNRRARTKLKQTEVDCELLKRCCETLTDENRRLHRELQELR-AL 244
                      69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046181.7E-2819135IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.606.0E-19142210IPR009057Homeodomain-like
SuperFamilySSF466897.7E-19144212IPR009057Homeodomain-like
PROSITE profilePS5007117.167151211IPR001356Homeobox domain
SMARTSM003891.0E-16153215IPR001356Homeobox domain
PfamPF000461.7E-16155209IPR001356Homeobox domain
CDDcd000861.14E-15155212No hitNo description
PROSITE patternPS000270186209IPR017970Homeobox, conserved site
SMARTSM003401.0E-23211254IPR003106Leucine zipper, homeobox-associated
PfamPF021834.9E-10211245IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MEMMVHGRRD EQYGGLGLGL GLGLSLGVAG GAADDEQPPP RRGAAPPPQQ QLCGWNGGGL  60
FSSSSSDHRG RSAMMACHDV IEMPFLRGID VNRAPAAETT TTTARGPSCR EEDEEPGASS  120
PNSTLSSLSG KRGAPSAATA AAAASDDEDS GGGSRKKLRL SKDQAAVLED TFKEHNTLNP  180
KQKAALARQL NLKPRQVEVW FQNRRARTKL KQTEVDCELL KRCCETLTDE NRRLHRELQE  240
LRALKLATAA AAPHHLYGAR VPPPTTLTMC PSCERVASAA TTTRNNSGAA PARPVPTRPW  300
PPAAAQRSSA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1153159SRKKLRL
2203211RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0654040.0AK065404.1 Oryza sativa Japonica Group cDNA clone:J013006I17, full insert sequence.
GenBankCT8329440.0CT832944.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA107F07, full insert sequence.
GenBankX966810.0X96681.2 Oryza sativa mRNA for DNA-binding protein (Oshox1 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015613269.11e-164PREDICTED: homeobox-leucine zipper protein HOX1
SwissprotQ406911e-166HOX1_ORYSI; Homeobox-leucine zipper protein HOX1
SwissprotQ7XC541e-166HOX1_ORYSJ; Homeobox-leucine zipper protein HOX1
TrEMBLA0A0E0BDT20.0A0A0E0BDT2_9ORYZ; Uncharacterized protein
STRINGORGLA10G0137100.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25873889
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.11e-53homeobox from Arabidopsis thaliana